PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G266800.1
Common NamePHAVU_007G266800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 212aa    MW: 24085.5 Da    PI: 9.124
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G266800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.52.6e-212471249
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        + +n+ n  vtfskRr+gi+KKA+EL +LC++++avi+fs++ +++ +
  Phvul.007G266800.1 24 KMSNEHNLRVTFSKRRTGIFKKASELATLCGVDIAVIMFSPSSQIFSF 71
                        679**************************************9998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.461575IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-291574IPR002100Transcription factor, MADS-box
CDDcd002656.05E-311683No hitNo description
SuperFamilySSF554551.44E-261692IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-181737IPR002100Transcription factor, MADS-box
PfamPF003194.0E-222571IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-183752IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-185273IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MDSKNMAKKN LKKTRGRQKI EIKKMSNEHN LRVTFSKRRT GIFKKASELA TLCGVDIAVI  60
MFSPSSQIFS FGSPNVDPVI QRYTAQGPPP LLTLDLNEAH STVDEGELHA QLNNLSDQMT  120
AEKKHEEALK RLMKDVEEHS WWAIPMENMN DSQLEKCKKM LEDLKERVNE KREKLLLQST  180
FSYNSQTQFF TGGNSFSSVN NTETIHPPLS L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J5e-181689174Myocyte-specific enhancer factor 2A
3p57_I5e-181689174Myocyte-specific enhancer factor 2A
3p57_D5e-181689174Myocyte-specific enhancer factor 2A
3p57_C5e-181689174Myocyte-specific enhancer factor 2A
3p57_B5e-181689174Myocyte-specific enhancer factor 2A
3p57_A5e-181689174Myocyte-specific enhancer factor 2A
3kov_J5e-181689174Myocyte-specific enhancer factor 2A
3kov_I5e-181689174Myocyte-specific enhancer factor 2A
3kov_B5e-181689174Myocyte-specific enhancer factor 2A
3kov_A5e-181689174Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007145776.11e-158hypothetical protein PHAVU_007G266800g
TrEMBLV7BL391e-157V7BL39_PHAVU; Uncharacterized protein
STRINGGLYMA10G10930.25e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13864521
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.16e-42AGAMOUS-like 62